>Several Other Sizes Are Also Available. Please Inquire. Default Size: 20ug
Updated Date: Stock Protein updated on 20170405
Research areas: Immunology
Target / Protein: TSLP
Biologically active: Not Tested
Expression system: Mammalian cell
Species of origin: Homo sapiens (Human)
Delivery time: 3-7 business days
Uniprot ID: Q969D9
AA Sequence: YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Tag info: N-terminal 6xHis-tagged
Expression Region: 29-159aa
Protein length: Full Length
MW: 18.9 kDa
Alternative Name(s):
Relevance: Isoform 1: Cytokine that induces the release of T-cell-attracting chemokines from monocytes and, in particular, enhances the maturation of CD11c+ dendritic cells. Can induce allergic inflammation by directly activating mast cells. Isoform 2: May act as an antimicrobial peptide in the oral cavity and on the skin.
Reference: "Cloning of human thymic stromal lymphopoietin (TSLP) and signaling mechanisms leading to proliferation."Quentmeier H., Drexler H.G., Fleckenstein D., Zaborski M., Armstrong A., Sims J.E., Lyman S.D.Leukemia 15:1286-1292(2001)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.