Recombinant Human Striated muscle preferentially expressed protein kinase(SPEG),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Striated muscle preferentially expressed protein kinase(SPEG),partial

CSB-EP022529HU
Regular price
$765.72 CAD
Sale price
$765.72 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Developmental Biology

Uniprot ID: Q15772

Gene Names: SPEG

Organism: Homo sapiens (Human)

AA Sequence: MQKARGTRGEDAGTRAPPSPGVPPKRAKVGAGGGAPVAVAGAPVFLRPLKNAAVCAGSDVRLRVVVSGTPQPSLRWFRDGQLLPAPAPEPSCLWLRRCGAQDAGVYSCMAQNE

Expression Region: 1-113aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 38.7 kDa

Alternative Name(s): Aortic preferentially expressed protein 1 ;APEG-1

Relevance: Isoform 3 may have a role in regulating the growth and differentiation of arterial smooth muscle cells.

Reference: APEG-1, a novel gene preferentially expressed in aortic smooth muscle cells, is down-regulated by vascular injury.Hsieh C.-M., Yoshizumi M., Endege W.O., Kho C.-J., Jain M.K., Kashiki S., de Los Santos R., Lee W.-S., Perrella M.A., Lee M.-E.J. Biol. Chem. 271:17354-17359(1996)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share