Recombinant Human Retinol-binding protein 4(RBP4) (Active)

Recombinant Human Retinol-binding protein 4(RBP4) (Active)

CSB-MP019483HU
Regular price
$586.44 CAD
Sale price
$586.44 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. Please contact us.

Research Areas:Cancer

Uniprot NO.:P02753

Uniprot Entry Name:

Gene Names:RBP4

Species:Homo sapiens (Human)

Source:Mammalian cell

Expression Region:19-201aa

Sequence:ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL

Protein Description:Full Length of Mature Protein

Tag Info:C-terminal hFc-tagged

Mol. Weight:50 kDa

Biological_Activity:?Measured by its binding ability in a functional ELISA. Immobilized RBP4 at 5 ?g/ml can bind TTR (CSB-MP025270HUh6), the EC50 is 695.0-970.1 ng/ml.

Purity:Greater than 94% as determined by SDS-PAGE.

Endotoxin:Less than 1.0 EU/ug as determined by LAL method.

Form:Lyophilized powder

Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Alternative Name/ Alias:(Plasma retinol-binding protein)(PRBP)(RBP)

Relevance:Retinol-binding protein that mediates retinol transport in blood plasma (PubMed:5541771). Delivers retinol from the liver stores to the peripheral tissues (Probable). Transfers the bound all-trans retinol to STRA6, that then facilitates retinol transport across the cell membrane (PubMed:22665496)

PubMed ID:

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Your list is ready to share