Recombinant Human Retinoic acid-induced protein 3(GPRC5A),partial

Recombinant Human Retinoic acid-induced protein 3(GPRC5A),partial

CSB-EP818781HU1
Regular price
$919.51 CAD
Sale price
$919.51 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Neuroscience

Uniprot ID:Q8NFJ5

Gene Names:GPRC5A

Organism:Homo sapiens (Human)

AA Sequence:TKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDYEVKKEGS

Expression Region:269-357aa

Sequence Info:Partial

Source:E.coli

Tag Info:N-terminal GST-tagged

MW:37.0 kDa

Alternative Name(s):G-protein coupled receptor family C group 5 member A;Phorbol ester induced gene 1;PEIG-1;Retinoic acid-induced gene 1 protein;RAIG-1

Relevance:Orphan receptor. Could be involved in modulating differentiation and maintaining homeostasis of epithelial cells. This retinoic acid-inducible GPCR provide evidence for a possible interaction between retinoid and G-protein signaling pathways. Functions as a negative modulator of EGFR signaling (By similarity). May act as a lung tumor suppressor.

Reference:"Identification of the retinoic acid-inducible Gprc5a as a new lung tumor suppressor gene." Tao Q., Fujimoto J., Men T., Ye X., Deng J., Lacroix L., Clifford J.L., Mao L., Van Pelt C.S., Lee J.J., Lotan D., Lotan R. J. Natl. Cancer Inst. 99:1668-1682(2007)

Purity:Greater than 90% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Lead Time Guidance:3-7 business days

Your list is ready to share