Size:100ug. Other sizes are also available. For further information, please contact us.
Research Areas:Others
Uniprot ID:P59666
Gene Names:DEFA3
Organism:Homo sapiens (Human)
AA Sequence:DIPEVVVSLAWDESLAPKHPGSRKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC
Expression Region:39-94aa
Sequence Info:Partial
Source:E.coli
Tag Info:N-terminal 6xHis-SUMO-tagged
MW:22.4 kDa
Alternative Name(s):Defensin, alpha 3 (HNP-3) (HP-3) (HP3) (HP 3-56) (Neutrophil defensin 2) (HNP-2) (HP-2) (HP2) (DEF3)
Relevance:Defensin 2 and defensin 3 have antibiotic, fungicide and antiviral activities. Has antimicrobial activity against Gram-negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane.
Reference:"Differentiation stage-specific expression of a gene during granulopoiesis." Wiedemann L.M., Francis G.E., Lamb R.F., Burns J.H., Winnie J.N., McKenzie E.D., Birnie G.D. Leukemia 3:227-234(1989)
Purity:Greater than 85% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:Defensin 2 and defensin 3 have antibiotic, fungicide and antiviral activities. Has antimicrobial activity against Gram-negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane.
Involvement in disease:
Subcellular Location:Secreted
Protein Families:Alpha-defensin family
Tissue Specificity:
Paythway:
HGNC Database Link:https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=HGNC:2762
UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Hs&CID=654448
KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?hsa:1668
STRING Database Link:https://string-db.org/network/9606.ENSP00000328359
OMIM Database Link:https://www.omim.org/entry/604522604522604522
Lead Time Guidance:13-23 business days