Recombinant Human NAD-dependent malic enzyme, mitochondrial protein(ME2) (Active)

Recombinant Human NAD-dependent malic enzyme, mitochondrial protein(ME2) (Active)

CSB-AP000101HU
Regular price
$1,868.40 CAD
Sale price
$1,868.40 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. Please contact us.

Research Areas:Signal Transduction

Uniprot NO.:P23368

Uniprot Entry Name:MAOM_HUMAN

Gene Names:ME2

Species:Homo sapiens (Human)

Source:E.Coli

Expression Region:19-584aa

Sequence:MLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWPESASSPPVITE+HHHHHH

Protein Description:Full Length of Mature Protein

Tag Info:C-terminal 6xHis-tagged

Mol. Weight:64.4 kDa

Biological_Activity:Malic Enzyme activity was assayed spectrophotometrically at 340nm as described in Mandela and Sauer (1975). The standard reaction mixture contained 50 mM Tris-HCl, 3 mM MnCl2, 5 mM malate, 0.12 mM NADP+, 2.5 mM fumarate. Assay was performed in a Beckman spectrophotometer. The Km value is 1.5 ± 0.6 mM

Purity:>95% as determined by SDS-PAGE and HPLC.

Endotoxin:Less than 1.0 EU/µg as determined by LAL method.

Form:Lyophilized powder

Buffer:Lyophilized from a 0.2?m filtered PBS, pH 7.4.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Alternative Name/ Alias:NAD-ME, Malic enzyme 2

Relevance:

PubMed ID:1993674; 11401430; 14702039; 16177791; 15489334; 12665801; 19608861; 21269460; 24275569; 10467136; 10700286; 12121650; 12962632

Function:

Involvement in disease:

Subcellular Location:Mitochondrion matrix

Protein Families:Malic enzymes family

Tissue Specificity:

Paythway:

HGNC Database Link:https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=HGNC:6984

UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Hs&CID=233119

KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?hsa:4200

STRING Database Link:https://string-db.org/network/9606.ENSP00000321070

OMIM Database Link:https://www.omim.org/entry/154270154270154270

Your list is ready to share