Recombinant Human Myosin regulatory light chain 2, skeletal muscle isoform(MYLPF)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Myosin regulatory light chain 2, skeletal muscle isoform(MYLPF)

CSB-EP856892HU
Regular price
$765.72 CAD
Sale price
$765.72 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Signal Transduction

Uniprot ID: Q96A32

Gene Names: MYLPF

Organism: Homo sapiens (Human)

AA Sequence: APKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRLNVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFLEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE

Expression Region: 2-169aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 34.9 kDa

Alternative Name(s): Fast skeletal myosin light chain 2MLC2B

Relevance:

Reference: Human fast skeletal myosin light chain 2 cDNA isolation, tissue specific expression of the single copy gene, comparative sequence analysis of isoforms and evolutionary relationships.Sachdev S., Raychowdhury M.K., Sarkar S.DNA Seq. 14:339-350(2003)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share