Recombinant Human Metallothionein-4(MT4)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Metallothionein-4(MT4)

CSB-EP015123HU
Regular price
$979.56 CAD
Sale price
$979.56 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171228

Research areas: Others

Target / Protein: MT4

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Homo sapiens (Human)

Delivery time: 3-7 business days

Uniprot ID: P47944

AA Sequence: MDPRECVCMSGGICMCGDNCKCTTCNCKTYWKSCCPCCPPGCAKCARGCICKGGSDKCSCCP

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-62aa

Protein length: Full Length

MW: 22.5 kDa

Alternative Name(s): Metallothionein-IV

Relevance: Seems to bind zinc and copper. Could play a special role in regulating zinc metabolism during the differentiation of stratified epithelia.

Reference: "Induction of a new metallothionein isoform (MT-IV) occurs during differentiation of stratified squamous epithelia." Quaife C.J., Findley S.D., Erickson J.C., Froelick G.J., Kelly E.J., Zambrowicz B.P., Palmiter R.D. Biochemistry 33:7250-7259(1994)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share