
Size:100ug. Other sizes are also available. Please contact us.
Research Areas:Cancer
Uniprot NO.:Q08722
Uniprot Entry Name:
Gene Names:CD47
Species:Homo sapiens (Human)
Source:Mammalian cell
Expression Region:19-139aa
Sequence:QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP
Protein Description:Partial
Tag Info:C-terminal hFc-tagged
Mol. Weight:41.5 kDa
Biological_Activity:?Measured by its binding ability in a functional ELISA. Immobilized SIRPA (CSB-MP021334HU) at 2 ?g/ml can bind human CD47, the EC50 of human CD47 protein is 65.91-82.42 ng/ml. ?Human SIRPA protein His/Myc tag (CSB-MP021334HU) captured on COOH chip can bind Human CD47 protein Fc tag (CSB-MP004940HU) with an affinity constant of 19.1 nM as detected by LSPR Assay.
Purity:Greater than 95% as determined by SDS-PAGE.
Endotoxin:Less than 1.0 EU/ug as determined by LAL method.
Form:Lyophilized powder
Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Alternative Name/ Alias:Antigenic surface determinant protein OA3?Integrin-associated protein??IAP??Protein MER6??CD47?
Relevance:Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins.
PubMed ID:
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link: