Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Transport
Uniprot ID: O75387
Gene Names: SLC43A1
Organism: Homo sapiens (Human)
AA Sequence: TLNWPIEAFPAPEEVNYTKKIKLSGLALDHKVTGDLFYTHVTTMGQRLSQKAPSLEDGSDAFMSPQDVRGTSENLPERSVPLRKSLCSPT
Expression Region: 214-303aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 13.9 kDa
Alternative Name(s): L-type amino acid transporter 3;Prostate cancer overexpressed gene 1 protein;Solute carrier family 43 member 1
Relevance: Sodium-independent, high affinity transport of large neutral amino acids. Has narrower substrate selectivity compared to SLC7A5 and SLC7A8 and mainly transports branched-chain amino acids and phenylalanine. Plays a role in the development of human prostate cancer, from prostatic intraepithelial neoplasia to invasive prostate cancer.
Reference: Identification of a novel transcript up-regulated in a clinically aggressive prostate carcinoma.Chuaqui R.F., Englert C.R., Strup S.E., Vocke C.D., Zhuang Z., Duray P.H., Bostwick D.G., Linehan W.M., Liotta L.A., Emmert-Buck M.R.Urology 50:302-307(1997)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.