Recombinant Human Intraflagellar transport protein 27 homolog(IFT27)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Intraflagellar transport protein 27 homolog(IFT27)

CSB-EP874822HU
Regular price
$765.72 CAD
Sale price
$765.72 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Signal Transduction

Uniprot ID: Q9BW83

Gene Names: IFT27

Organism: Homo sapiens (Human)

AA Sequence: MVKLAAKCILAGDPAVGKTALAQIFRSDGAHFQKSYTLTTGMDLVVKTVPVPDTGDSVELFIFDSAGKELFSEMLDKLWESPNVLCLVYDVTNEESFNNCSKWLEKARSQAPGISLPGVLVGNKTDLAGRRAVDSAEARAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA

Expression Region: 1-186aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 36.5 kDa

Alternative Name(s): Putative GTP-binding protein RAY-likeRab-like protein 4

Relevance: Small GTPase-like component of the intraflagellar transport (IFT) complex B that promotes the exit of the BBSome complex from cilia via its interaction with ARL6 . Not involved in entry of the BBSome complex into cilium. Prevents aggregation of GTP-free ARL6 . Required for hedgehog signaling. Forms a subcomplex within the IFT complex B with IFT25 .

Reference: Reevaluating human gene annotation a second-generation analysis of chromosome 22.Collins J.E., Goward M.E., Cole C.G., Smink L.J., Huckle E.J., Knowles S., Bye J.M., Beare D.M., Dunham I.Genome Res. 13:27-36(2003)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share