Recombinant Human Homeobox protein Hox-A2(HOXA2),partial

Recombinant Human Homeobox protein Hox-A2(HOXA2),partial

CSB-YP010652HU
Regular price
$1,267.70 CAD
Sale price
$1,267.70 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Others

Uniprot ID:O43364

Gene Names:HOXA2

Organism:Homo sapiens (Human)

AA Sequence:PPVADTFQSSSIKTSTLSHSTLIPPPFEQTIPSLNPGSHPRHGAGGRPKPSPAGSRGSPVPAGALQPPEYPWMKEKKAAKKTALLPAAAAAATAAATGP

Expression Region:26-124aa

Sequence Info:Partial

Source:Yeast

Tag Info:N-terminal 6xHis-tagged

MW:12

Alternative Name(s):Homeobox protein Hox-1K (HOX1K)

Relevance:Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.

Reference:"HOXA2 haploinsufficiency in dominant bilateral microtia and hearing loss." Brown K.K., Viana L.M., Helwig C.C., Artunduaga M.A., Quintanilla-Dieck L., Jarrin P., Osorno G., McDonough B., Depalma S.R., Eavey R.D., Seidman J.G., Seidman C.E. Hum. Mutat. 34:1347-1351(2013)

Purity:Greater than 90% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Lead Time Guidance:25-35 business days

Your list is ready to share