Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Cancer
Uniprot ID: Q13069
Gene Names: GAGE5
Organism: Homo sapiens (Human)
AA Sequence: MSWRGRSTYYWPRPRRYVQPPEVIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC
Expression Region: 1-117aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 39.9 kDa
Alternative Name(s): Cancer/testis antigen 4.5 ;CT4.5
Relevance:
Reference: A new family of genes coding for an antigen recognized by autologous cytolytic T lymphocytes on a human melanoma.van den Eynde B., Peeters O., de Backer O., Gaugler B., Lucas S., Boon T.J. Exp. Med. 182:689-698(1995)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.