Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: Q9BSJ8
Gene Names: ESYT1
Organism: Homo sapiens (Human)
AA Sequence: MERSPGEGPSPSPMDQPSAPSDPTDQPPAAHAKPDPGSGGQPAGPGAAGEALAVLTSFGRRLLVLIPVYLAGAVGLSVGFVLFGLALYLGWRRVRDEKERSLRAARQLLDDEEQLTAKTLYMSHRELPAWVSFPDVEKAEWLNKIVAQVWPFLGQYMEKLLAETVAPAVRGSNPHLQTFTFTRVELGEKPLRIIGVKVHPGQRKEQILLDLNISYVGDVQIDVEVKKYFCKAGVKGMQLHGVLRV
Expression Region: 1-245aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 53.7 kDa
Alternative Name(s): Membrane-bound C2 domain-containing protein
Relevance: Binds glycerophospholipids in a barrel-like domain and may play a role in cellular lipid transport . Binds calcium (via the C2 domains) and translocates to sites of contact between the endoplasmic reticulum and the cell mbrane in response to increased cytosolic calcium levels. Helps tether the endoplasmic reticulum to the cell mbrane and promotes the formation of appositions between the endoplasmic reticulum and the cell mbrane.
Reference: E-Syts, a family of membranous Ca2+-sensor proteins with multiple C2 domains.Min S.-W., Chang W.-P., Suedhof T.C.Proc. Natl. Acad. Sci. U.S.A. 104:3823-3828(2007)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.