Recombinant Human Dynein light chain 1, Cytoplasmic domain(DYNLL1)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Dynein light chain 1, Cytoplasmic domain(DYNLL1)

CSB-RP012844h
Regular price
$765.72 CAD
Sale price
$765.72 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Apoptosis

Uniprot ID: P63167

Gene Names: DYNLL1

Organism: Homo sapiens (Human)

AA Sequence: MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG

Expression Region: 1-89aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 37.4 kDa

Alternative Name(s): 8KDA dynein light chain ;DLC8Dynein light chain LC8-type 1;Protein inhibitor of neuronal nitric oxide synthase ;PIN

Relevance: Acts as one of several non-catalytic accessory components of the Cytoplasmic domain dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic domain dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in changing or maintaining the spatial distribution of cytoskeletal structures.Binds and inhibits the catalytic activity of neuronal nitric oxide synthase.Promotes transactivation functions of ESR1 and plays a role in the nuclear localization of ESR1.Regulates apoptotic activities of BCL2L11 by sequestering it to microtubules. Upon apoptotic stimuli the BCL2L11-DYNLL1 complex dissociates from Cytoplasmic domain dynein and translocates to mitochondria and sequesters BCL2 thus neutralizing its antiapoptotic activity.

Reference: Biochemical and structural characterization of the Pak1-LC8 interaction.Lightcap C.M., Sun S., Lear J.D., Rodeck U., Polenova T., Williams J.C.J. Biol. Chem. 283:27314-27324(2008)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share