Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Cancer
Uniprot ID: P10645
Gene Names: CHGA
Organism: Homo sapiens (Human)
AA Sequence: QAKREEEEEEEEEAEAGEEAVPEEEGPTVVLNPHPSLGYKEIRKGESRSEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFRGGKSGELEQEEERLSKEWEDSKRWSKMDQLAKELTAEKRLEGQEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQLQALRRG
Expression Region: 224-457aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 53.4 kDa
Alternative Name(s): Pituitary secretory protein I ;SP-I
Relevance: Pancreastatin: Strongly inhibits glucose induced insulin release from the pancreas.Catestatin: Inhibits catecholamine release from chromaffin cells and noradrenergic neurons by acting as a non-competitive nicotinic cholinergic antagonist . Displays antibacterial activity against Gram-positive bacteria S.aureus and M.luteus, and Gram-negative bacteria E.coli and P.aeruginosa . Can induce mast cell migration, degranulation and production of cytokines and chokines . Acts as a potent scavenger of free radicals in vitro . May play a role in the regulation of cardiac function and blood pressure .
Reference: The primary structure of human chromogranin A and pancreastatin.Konecki D.S., Benedum U.M., Gerdes H.-H., Huttner W.B.J. Biol. Chem. 262:17026-17030(1987)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.