Recombinant Human Chromodomain-helicase-DNA-binding protein 4(CHD4) ,partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Chromodomain-helicase-DNA-binding protein 4(CHD4) ,partial

CSB-RP010974h
Regular price
$765.72 CAD
Sale price
$765.72 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Epigenetics and Nuclear Signaling

Uniprot ID: Q14839

Gene Names: CHD4

Organism: Homo sapiens (Human)

AA Sequence: MASGLGSPSPCSAGSEEEDMDALLNNSLPPPHPENEEDPEEDLSETETPKLKKKKKPKKPRDPKIPKSKRQKKERMLLCRQLGDSSGEGPEFVEEEEEVALRSDSEGSDYTPGKKKKKKLGPKKEKKSKSKRKEEEEEEDDDDDSKEPKSSAQLLEDWGMEDIDHVFSEEDYRTLTNYKAFSQFVRPLIAAKNPKIAVSKMMMVLGAKWREFSTNNPFK

Expression Region: 1-219aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 28.9 kDa

Alternative Name(s): ATP-dependent helicase CHD4Mi-2 autoantigen 218KDA protein;Mi2-beta

Relevance: Component of the histone deacetylase NuRD complex which participates in the rodeling of chromatin by deacetylating histones.

Reference: The major dermatomyositis specific Mi-2 autoantigen is a presumed helicase involved in transcriptional activation.Seelig H.P., Moosbrugger I., Ehrfeld H., Fink T., Renz M., Genth E.Arthritis Rheum. 38:1389-1399(1995)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share