Recombinant Human CD59 glycoprotein(CD59)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human CD59 glycoprotein(CD59)

CSB-YP004947HU
Regular price
$855.36 CAD
Sale price
$855.36 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171018

Research areas: Cardiovascular

Target / Protein: CD59

Biologically active: Not Tested

Expression system: Yeast

Species of origin: Homo sapiens (Human)

Delivery time: 3-7 business days

Uniprot ID: P13987

AA Sequence: LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN

Tag info: N-terminal 6xHis-tagged

Expression Region: 26-102aa

Protein length: Full Length

MW: 11 kDa

Alternative Name(s): 1F5 antigen20KDA homologous restriction factor ;HRF-20 ;HRF20MAC-inhibitory protein ;MAC-IPMEM43 antigen;Membrane attack complex inhibition factor ;MACIFMembrane inhibitor of reactive lysis ;MIRLProtectin; CD59

Relevance: Potent inhibitor of the complent mbrane attack complex (MAC) action. Acts by binding to the C8 and/or C9 complents of the assbling MAC, thereby preventing incorporation of the multiple copies of C9 required for complete formation of the osmolytic pore. This inhibitor appears to be species-specific. Involved in signal transduction for T-cell activation complexed to a protein tyrosine kinase.The soluble form from urine retains its specific complent binding activity, but exhibits greatly reduced ability to inhibit MAC assbly on cell mbranes.

Reference: CD59, an LY-6-like protein expressed in human lymphoid cells, regulates the action of the complement membrane attack complex on homologous cells.Davies A., Simmons D.L., Hale G., Harrison R.A., Tighe H., Lachmann P.J., Waldmann H.J. Exp. Med. 170:637-654(1989)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share