
Size:100ug. Other sizes are also available. Please contact us.
Research Areas:Cancer
Uniprot NO.:Q7Z6A9
Uniprot Entry Name:
Gene Names:BTLA
Species:Homo sapiens (Human)
Source:Mammalian cell
Expression Region:31-150aa
Sequence:KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMAS
Protein Description:Partial
Tag Info:C-terminal hFc-Myc-tagged
Mol. Weight:43.9 kDa
Biological_Activity:?Measured by its binding ability in a functional ELISA. Immobilized BTLA at 5 ?g/ml can bind biotinylated human TNFRSF14 (CSB-MP842173HU-A), the EC50 is 137.8-233.4 ng/ml.
Purity:Greater than 94% as determined by SDS-PAGE.
Endotoxin:Less than 1.0 EU/ug as determined by LAL method.
Form:Lyophilized powder
Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Alternative Name/ Alias:(B- and T-lymphocyte-associated protein)(CD272)
Relevance:Inhibitory receptor on lymphocytes that negatively regulates antigen receptor signaling via PTPN6/SHP-1 and PTPN11/SHP-2 (PubMed:12796776, PubMed:14652006, PubMed:15568026, PubMed:18193050). May interact in cis (on the same cell) or in trans (on other cells) with TNFRSF14 (PubMed:19915044). In cis interactions, appears to play an immune regulatory role inhibiting in trans interactions in naive T cells to maintain a resting state. In trans interactions, can predominate during adaptive immune response to provide survival signals to effector T cells (PubMed:19915044).
PubMed ID:
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link: