>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20171228
Research areas: Others
Target / Protein: ORF3
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Hepatitis E virus genotype 1 (isolate Human/Pakistan/Sar-55) (HEV-1)
Delivery time: 3-7 business days
Uniprot ID: O90299
AA Sequence: MGSRPWALGLFCCCSSCFCLCCSRHRPVSRLAAVVGGAAAVPAVVSGVTGLILSPSQSPIFIQPTPSPRMSPLRPGLDLVFANPSDHSAPLGATRPSAPPLPHVVDLPQLGPRR
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 1-114aa
Protein length: Full Length
MW: 27.8 kDa
Alternative Name(s):
Relevance: May act as a viral regulatory protein involved in the modulation of mitogenic signaling pathways. May be involved in virion morphogenesis and viral pathogenesis. Expedites the processing and secretion of AMBP from the hepatocyte.
Reference: The ORF3 protein of hepatitis E virus interacts with hemopexin by means of its 26 amino acid N-terminal hydrophobic domain II.Ratra R., Kar-Roy A., Lal S.K.Biochemistry 47:1957-1969(2008)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.