Recombinant Hepatitis E virus genotype 1 Non-structural polyprotein pORF1 (ORF1)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Hepatitis E virus genotype 1 Non-structural polyprotein pORF1 (ORF1)

CSB-EP327230HGE
Regular price
$1,151.28 CAD
Sale price
$1,151.28 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P33424

Gene Names: ORF1

Organism: Hepatitis E virus genotype 1 (isolate Human/Pakistan/Sar-55) (HEV-1)

AA Sequence: EVFWNHPIQRVIHNELELYCRARSGRCLEIGAHPRSINDNPNVVHRCFLRPAGRDVQRWYTAPTRGPAANCRRSALRGLPAADRTYCFDGFSGCNFPAETGIALYSLHDMSPSDVAEAMFRHGMTRLYAALHLPPEVLLPPGTYRTASYLLIHDGRRVVVTYEGDTSAGYNHDVSNLRSWI

Expression Region: 60-240aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 24.4 kDa

Alternative Name(s):

Relevance: Methyltransferase displays a Cytoplasmic domain capping enzyme activity. This function is necessary since all viral RNAs are synthesized in the cytoplasm, and host capping enzymes are restricted to the nucleus. The enzymatic reaction involves a covalent link between 7-methyl-GMP and the methyltransferase, whereas eukaryotic capping enzymes form a covalent complex only with GMP. Methyltransferase catalyzes transfer of a methyl group from S-adenosylmethionine to GTP and GDP to yield m7GTP or m7GDP. GMP, GpppG, and GpppA were poor substrates for the methyltransferase. This enzyme also displays guanylyltransferase activity to form a covalent complex, methyltransferase-m7GMP, from which 7-methyl-GMP is transferred to the mRNA to create the cap structure. Cap analogs such as m7GTP, m7GDP, et2m7GMP, and m2et7GMP inhibit the methyltransferase reaction .RNA-directed RNA polymerase plays an essential role in the virus replication. Binds to the 3'-end of the genomic RNA, probably to initiate replication ..

Reference: Characterization of a prototype strain of hepatitis E virus.Tsarev S.A., Emerson S.U., Reyes G.R., Tsareva T.S., Legters L.J., Malik I.A., Iqbal M., Purcell R.H.Proc. Natl. Acad. Sci. U.S.A. 89:559-563(1992)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share