Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Helianthus annuus (Common sunflower)
Uniprot NO.:Q8VY39
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGGGRVAHPVLKGPSVVKELVIGTVLGLAAGGLWKMHHWNEQRKTRAFYDLLEKGEISVV VDEE
Protein Names:Recommended name: Cytochrome c oxidase subunit 5C-2 Alternative name(s): Cytochrome c oxidase polypeptide Vc-2
Gene Names:Name:COX5C2
Expression Region:1-64
Sequence Info:full length protein