Size:100ug. Other sizes are also available. For further information, please contact us.
Research Areas:Cancer
Uniprot ID:Q6LA37
Gene Names:IL23A
Organism:Cavia porcellus (Guinea pig)
AA Sequence:RAVSGSSNPSWTQCQQLSQKLCTLAWSAHPSVGHVEPPREEADEETTDYVPHILCGDGCDPQGLKDNSQFCLQRIYQGLVFYQNLLGSDIFTGEPPLFPDGPVSQLHASLLGLSQLLQPEVHQWEPQIPSLSPNQPWQRLLLRIKILRSFQAFVAVAARVFGHGAATLTP
Expression Region:20-189aa
Sequence Info:Full Length of Mature Protein
Source:E.coli
Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW:26.2 kDa
Alternative Name(s):Interleukin-23 subunit alpha;IL-23 subunit alpha;IL-23-A;Interleukin-23 subunit p19;IL-23p19
Relevance:Associates with IL12B to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.
Reference:"Molecular cloning and functional characterization of guinea pig interleukin-23." Shiratori I., Seya T. Submitted (MAR-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA].
Purity:Greater than 90% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
Lead Time Guidance:3-7 business days