Size:100ug. Other sizes are also available. For further information, please contact us.
Research Areas:Cardiovascular
Uniprot ID:P03712
Gene Names:D
Organism:Escherichia phage lambda (Bacteriophage lambda)
AA Sequence:MTSKETFTHYQPQGNSDPAHTATAPGGLSAKAPAMTPLMLDTSSRKLVAWDGTTDGAAVGILAVAADQTSTTLTFYKSGTFRYEDVLWPEAASDETKKRTAFAGTAISIV
Expression Region:1-110aa
Sequence Info:Full Length
Source:E.coli
Tag Info:N-terminal 6xHis-KSI-tagged
MW:26.9 kDa
Alternative Name(s):Capsid decoration protein(Auxiliary protein D)(Gene product D)(gpD)(Major capsid protein D)
Relevance:Stabilizes the expansion of the capsid head shell after genome packaging. The packaging of viral genome in the procapsid triggers a dramatic reconfiguration of the capsid shell, expanding from roughly 50nm to 60nm while the capsid thickness decreases. 415 capsid decoration protein molecules cooperatively bind the expanded capsid, thereby stabilizing the mature capsid shell.
Reference:"Bacteriophage lambda stabilization by auxiliary protein gpD: timing, location, and mechanism of attachment determined by cryo-EM." Lander G.C., Evilevitch A., Jeembaeva M., Potter C.S., Carragher B., Johnson J.E. Structure 16:1399-1406(2008)
Purity:Greater than 85% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
Lead Time Guidance:13-23 business days