
Size:100ug. Other sizes are also available. For further information, please contact us.
Research Areas:Signal Transduction
Uniprot ID:P69776
Gene Names:lpp
Organism:Escherichia coli (strain K12)
AA Sequence:CSSNAKIDQLSSDVQTLNAKVDQLSNDVNAMRSDVQAAKDDAARANQRLDNMATKYRK
Expression Region:21-78aa
Sequence Info:Full Length of Mature Protein
Source:E.coli
Tag Info:N-terminal 6xHis-KSI-tagged
MW:21.8 kDa
Alternative Name(s):Braun lipoprotein (Murein-lipoprotein) (mlpA) (mulI)
Relevance:Interacts with the peptidoglycan both covalently and noncovalently. This interaction contributes to the maintenance of the structural and functional integrity of the cell envelope.
Reference:"Roles of the hydrophobic cavity and lid of LolA in the lipoprotein transfer reaction in Escherichia coli." Watanabe S., Matsuyama S., Tokuda H. J. Biol. Chem. 281:3335-3342(2006)
Purity:Greater than 85% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:Interacts with the peptidoglycan both covalently and noncovalently. This interaction contributes to the maintenance of the structural and functional integrity of the cell envelope.
Involvement in disease:
Subcellular Location:Cell outer membrane, Lipid-anchor, Cell outer membrane, Peptidoglycan-anchor
Protein Families:Lpp family
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?ecj:JW1667
STRING Database Link:https://string-db.org/network/316385.ECDH10B_1811
OMIM Database Link:
Lead Time Guidance:3-7 business days