Recombinant Escherichia coli K99 fimbrial protein(fanC)

Recombinant Escherichia coli K99 fimbrial protein(fanC)

CSB-EP322992ENLe1
Regular price
$986.04 CAD
Sale price
$986.04 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: others

Target / Protein: fanC

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Escherichia coli

Delivery time: 3-7 business days

Uniprot ID: P18103

AA Sequence: NTGTINFNGKITSATCTIDPEVNGNRTSTIDLGQAAISGHGTVVDFKLKPAPGSNDCLAKTNARIDWSGSMNSLGFNNTASGNTAAKGYHMTLRATNVGNGSGGANINTSFTTAEYTHTSAIQSFNYSAQLKKDDRAPSNGGYKAGVFTTSASFLVTYM

Tag info: NO-tagged

Expression Region: 23-181aa

Protein length: Full Length of Mature Protein

MW: 16.5 kDa

Alternative Name(s):

Relevance: Fimbriae (also called pili), polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, enable bacteria to colonize the epithelium of specific host organs. FanC is the main component of the K99 fimbriae.

Reference: "The penultimate tyrosine residue of the K99 fibrillar subunit is essential for stability of the protein and its interaction with the periplasmic carrier protein." Simons B.L., Rathman P., Maij C.R., Oudega B., de Graaf F.K. FEMS Microbiol. Lett. 55:107-112(1990)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share