
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Equine arteritis virus (strain Bucyrus) (EAV)
Uniprot NO.:Q91DM1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:GLVWSLISNSIQTIIADFAISVIDAALFFLMLLALAVVTVFLFWLIVAIGRSLVARCSRG ARYRPV
Protein Names:Recommended name: Envelope small membrane protein Short name= Protein E Alternative name(s): Glycoprotein 2a Short name= Protein GP2a
Gene Names:Name:GP2a ORF Names:2a
Expression Region:2-67
Sequence Info:full length protein