>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170725
Research areas: others
Target / Protein:
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Cupressus arizonica (Arizona cypress) (Callitropsis arizonica)
Delivery time: 3-7 business days
Uniprot ID: Q9SCG9
AA Sequence: DNPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADVHLGNGGPCLFMRKASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRSTRDAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVVA
Tag info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region: 22-367aa
Protein length: Full Length of Mature Protein
MW: 42.6 kDa
Alternative Name(s): Major pollen allergen Cup a 1 Allergen: Cup a 1
Relevance: Has pectate lyase activity.
Reference: "A modified protocol for RNA isolation from high polysaccharide containing Cupressus arizonica pollen. Applications for RT-PCR and phage display library construction." Pico de Coana Y., Parody N., Fernandez-Caldas E., Alonso C. Mol. Biotechnol. 44:127-132(2010)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.