>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170725
Research areas: others
Target / Protein:
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Crotalus adamanteus (Eastern diamondback rattlesnake)
Delivery time: 3-7 business days
Uniprot ID: P34179
AA Sequence: QQNLPQRYIELVVVADRRVFMKYNSDLNIIRTRVHEIVNIINGFYRSLNIDVSLVNLEIWSGQDPLTIQSSSSNTLNSEGLWREKVLLNKKKKDNAQLLTAIEFKCETLGKAYLNSMCNPRSSVGIVKDHSPINLLVAVTMAHELGHNLGMEHDGKDCLRGASLCIMRPGLTPGRSYEFSDDSMGYYQKFLNQYKPQCILNKP
Tag info: N-terminal 6xHis-tagged
Expression Region: 1-203aa
Protein length: Full Length
MW: 27.1 kDa
Alternative Name(s): Adamalysin II Proteinase II
Relevance: Has no significant hemorrhagic activity, but inactivates serpins by limited proteolysis of their reactive-site loops.
Reference: "First structure of a snake venom metalloproteinase: a prototype for matrix metalloproteinases/collagenases." Gomis-Rueth F.-X., Kress L.F., Bode W. EMBO J. 12:4151-4157(1993)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.