Recombinant Crab-eating macaque Apolipoprotein C-III(APOC3)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Crab-eating macaque Apolipoprotein C-III(APOC3)

CSB-YP001933MOV
Regular price
$612.45 CAD
Sale price
$612.45 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Cardiovascular

Uniprot ID: P18659

Gene Names: APOC3

Organism: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

AA Sequence: SEAEDTSLLGFMQGYMQHATKTAKDALTSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKLSGFWDLNPEAKPTLAEAA

Expression Region: 21-99aa

Sequence Info: Full Length of Mature Protein

Source: Yeast

Tag Info: N-terminal 6xHis-sumostar-tagged

MW: 24.7 kDa

Alternative Name(s): Apolipoprotein C3

Relevance: Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assembly and secretion; extracellularly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs). Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by remnant receptors. Formed of several curved helices connected via semiflexible hinges, so that it can wrap tightly around the curved micelle surface and easily adapt to the different diameters of its natural binding partners.

Reference: "Homologues of the human C and A apolipoproteins in the Macaca fascicularis (cynomolgus) monkey." Herbert P.N., Bausserman L.L., Lynch K.M., Saritelli A.L., Kantor M.A., Nicolosi R.J., Shulman R.S. Biochemistry 26:1457-1463(1987)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share