Recombinant chicken Interleukin-8(CXCL8),partial

Recombinant chicken Interleukin-8(CXCL8),partial

CSB-RP157874ce1
Regular price
$986.04 CAD
Sale price
$986.04 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Others

Target / Protein: CXCL8

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Gallus gallus (Chicken)

Delivery time: 3-7 business days

Uniprot ID: P08317

AA Sequence: ALSQGRTLVKMGNELRCQCISTHSKFIHPKSIQDVKLTPSGPHCKNVEIIATLKDGREVCLDPTAPWVQLIVKALMAKAQLNSDAP

Tag info: NO-tagged

Expression Region: 17-102aa

Protein length: Partial

MW: 9.4 kDa

Alternative Name(s): 9E3 C-X-C motif chemokine 8 CEF-4 Chemokine (C-X-C motif) ligand 8 Embryo fibroblast protein 1

Relevance: May be an autocrine factor that promotes the growth of fibroblasts and is involved in the neoplastic transformation of fibroblasts by v-Src. Chemotactic for peripheral blood mononuclear cells as well as for heterophils.

Reference: "Constitutive expression of a gene encoding a polypeptide homologous to biologically active human platelet protein in Rous sarcoma virus-transformed fibroblasts." Bedard P.-A., Alcorta D., Simmons D., Luk K.-C., Erikson R.L. Proc. Natl. Acad. Sci. U.S.A. 84:6715-6719(1987)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share