Recombinant Chicken Interferon type B(IFNB)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Chicken Interferon type B(IFNB)

CSB-EP838568CH-GB
Regular price
$979.56 CAD
Sale price
$979.56 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171228

Research areas: Others

Target / Protein: IFNB

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Gallus gallus (Chicken)

Delivery time: 3-7 business days

Uniprot ID: Q90873

AA Sequence: CNHLRHQDANFSWKSLQLLQNTAPPPPQPCPQQDVTFPFPETLLKSKDKKQAAITTLRILQHLFNMLSSPHTPKHWIDRTRHSLLNQIQHYIHHLEQCFVNQGTRSQRRGPRNAHLSINKYFRSIHNFLQHNNYSACTWDHVRLQARDCFRHVDTLIQWMKSRAPLTASSKRLNTQ

Tag info: N-terminal 6xHis-tagged

Expression Region: 28-203aa

Protein length: Full Length of Mature Protein

MW: 24.8 kDa

Alternative Name(s): IFN2

Relevance: Has antiviral activities.

Reference: "A family of genes coding for two serologically distinct chicken interferons." Sick C., Schultz U., Staeheli P. J. Biol. Chem. 271:7635-7639(1996)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share