Size:100ug. Other sizes are also available. For further information, please contact us.
Research Areas:Cardiovascular
Uniprot ID:P35541
Gene Names:SAA1
Organism:Bos taurus (Bovine)
AA Sequence:QWMSFFGEAYEGAKDMWRAYSDMREANYKGADKYFHARGNYDAAQRGPGGAWAAKVISDARENIQRFTDPLFKGTTSGQGQEDSRADQAANEWGRSGKDPNHFRPAGLPDKY
Expression Region:19-130aa
Sequence Info:Full Length of Mature Protein
Source:E.coli
Tag Info:N-terminal 6xHis-SUMO-tagged and C-terminal Myc-tagged
MW:30.1 kDa
Alternative Name(s):Amyloid fibril protein AA (SAA)
Relevance:Major acute phase reactant. Apolipoprotein of the HDL complex.
Reference:"A unique insertion in the primary structure of bovine amyloid AA protein." Benson M.D., Dibartola S.P., Dwulet F.E. J. Lab. Clin. Med. 113:67-72(1989)
Purity:Greater than 85% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:Major acute phase reactant. Apolipoprotein of the HDL complex.
Involvement in disease:Reactive, secondary amyloidosis is characterized by the extracellular accumulation in various tissues of the SAA protein. These deposits are highly insoluble and resistant to proteolysis; they disrupt tissue structure and compromise function.
Subcellular Location:Secreted
Protein Families:SAA family
Tissue Specificity:Expressed by the liver; secreted in plasma.
Paythway:
HGNC Database Link:
UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Bt&CID=88760
KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?bta:506412
STRING Database Link:https://string-db.org/network/9913.ENSBTAP00000030310
OMIM Database Link:
Lead Time Guidance:3-7 business days