Recombinant Bovine Serum amyloid A protein(SAA1)

Recombinant Bovine Serum amyloid A protein(SAA1)

CSB-EP020656BO
Regular price
$1,131.52 CAD
Sale price
$1,131.52 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Cardiovascular

Uniprot ID:P35541

Gene Names:SAA1

Organism:Bos taurus (Bovine)

AA Sequence:QWMSFFGEAYEGAKDMWRAYSDMREANYKGADKYFHARGNYDAAQRGPGGAWAAKVISDARENIQRFTDPLFKGTTSGQGQEDSRADQAANEWGRSGKDPNHFRPAGLPDKY

Expression Region:19-130aa

Sequence Info:Full Length of Mature Protein

Source:E.coli

Tag Info:N-terminal 6xHis-SUMO-tagged and C-terminal Myc-tagged

MW:30.1 kDa

Alternative Name(s):Amyloid fibril protein AA (SAA)

Relevance:Major acute phase reactant. Apolipoprotein of the HDL complex.

Reference:"A unique insertion in the primary structure of bovine amyloid AA protein." Benson M.D., Dibartola S.P., Dwulet F.E. J. Lab. Clin. Med. 113:67-72(1989)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:Major acute phase reactant. Apolipoprotein of the HDL complex.

Involvement in disease:Reactive, secondary amyloidosis is characterized by the extracellular accumulation in various tissues of the SAA protein. These deposits are highly insoluble and resistant to proteolysis; they disrupt tissue structure and compromise function.

Subcellular Location:Secreted

Protein Families:SAA family

Tissue Specificity:Expressed by the liver; secreted in plasma.

Paythway:

HGNC Database Link:

UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Bt&CID=88760

KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?bta:506412

STRING Database Link:https://string-db.org/network/9913.ENSBTAP00000030310

OMIM Database Link:

Lead Time Guidance:3-7 business days

Your list is ready to share