Recombinant Bovine Odorant-binding protein

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Bovine Odorant-binding protein

CSB-MP362133BO
Regular price
$790.56 CAD
Sale price
$790.56 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 20ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 15-25 working days

Research Topic: Others

Uniprot ID: P07435

Gene Names: N/A

Organism: Bos taurus (Bovine)

AA Sequence: AQEEEAEQNLSELSGPWRTVYIGSTNPEKIQENGPFRTYFRELVFDDEKGTVDFYFSVKRDGKWKNVHVKATKQDDGTYVADYEGQNVFKIVSLSRTHLVAHNINVDKHGQTTELTELFVKLNVEDEDLEKFWKLTEDKGIDKKNVVNFLENEDHPHPE

Expression Region: 1-159aa

Sequence Info: Full Length

Source: Mammalian cell

Tag Info: N-terminal 10xHis-tagged

MW: 22 kDa

Alternative Name(s): Olfactory mucosa pyrazine-binding protein

Relevance: This protein binds a wide variety of chemical odorants.

Reference: "Three-dimensional structure and active site of three hydrophobic molecule-binding proteins with significant amino acid sequence similarity." Monaco H.L., Zanotti G. Biopolymers 32:457-465(1992)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share