>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20171018
Research areas: Others
Target / Protein: btfP
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Bacteroides fragilis
Delivery time: 3-7 business days
Uniprot ID: P54355
AA Sequence: ACSNEADSLTTSIDAPVTASIDLQSVSYTDLATQLNDVSDFGKMIILKDNGFNRQVHVSMDKRTKIQLDNENVRLFNGRDKDSTSFILGDEFAVLRFYRNGESISYIAYKEAQMMNEIAEFYAAPFKKTRAINEKEAFECIYDSRTRSAGKDIVSVKINIDKAKKILNLPECDYINDYIKTPQVPHGITESQTRAVPSEPKTVYVICLRENGSTIYPNEVSAQMQDAANSVYAVHGLKRYVNFHFVLYTTEYSCPSGDAKEGLEGFTASLKSNPKAEGYDDQIYFLIRWGTWDNKILGMSWFNSYNVNTASDFEASGMSTTQLMYPGVMAHELGHILGAEHTDNSKDLMYATFTGYLSHLSEKNMDIIAKNLGWEAADGD
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 26-405aa
Protein length: Full Length
MW: 58.6 kDa
Alternative Name(s): Enterotoxin
Relevance: Diarrheal toxin that hydrolyzes gelatin, azocoll, actin, tropomyosin, and fibrinogen.
Reference: "Cloning and characterization of the gene for the metalloprotease enterotoxin of Bacteroides fragilis."Kling J.J., Wright R.L., Moncrief J.S., Wilkins T.D.FEMS Microbiol. Lett. 146:279-284(1997)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.