Recombinant Arabidopsis thaliana Histone deacetylase HDT2(HDT2)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Arabidopsis thaliana Histone deacetylase HDT2(HDT2)

CSB-YP684969DOA
Regular price
$1,263.60 CAD
Sale price
$1,263.60 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171228

Research areas: Others

Target / Protein: HDT2

Biologically active: Not Tested

Expression system: Yeast

Species of origin: Arabidopsis thaliana (Mouse-ear cress)

Delivery time: 3-7 business days

Uniprot ID: Q56WH4

AA Sequence: MEFWGVAVTPKNATKVTPEEDSLVHISQASLDCTVKSGESVVLSVTVGGAKLVIGTLSQDKFPQISFDLVFDKEFELSHSGTKANVHFIGYKSPNIEQDDFTSSDDEDVPEAVPAPAPTAVTANGNAGAAVVKADTKPKAKPAEVKPAEEKPESDEEDESDDEDESEEDDDSEKGMDVDEDDSDDDEEEDSEDEEEEETPKKPEPINKKRPNESVSKTPVSGKKAKPAAAPASTPQKTEEKKKGGHTATPHPAKKGGKSPVNANQSPKSGGQSSGGNNNKKPFNSGKQFGGSNNKGSNKGKGKGRA

Tag info: N-terminal 6xHis-tagged

Expression Region: 1-306aa

Protein length: Full Length

MW: 34.3 kDa

Alternative Name(s): HD-tuins protein 2 Histone deacetylase 2b

Relevance: Probably mediates the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events.

Reference: "Functional analysis of HD2 histone deacetylase homologues in Arabidopsis thaliana."Wu K., Tian L., Malik K., Brown D., Miki B.Plant J. 22:19-27(2000)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share