Recombinant Arabidopsis thaliana Chorismate mutase, chloroplastic(CM1),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Arabidopsis thaliana Chorismate mutase, chloroplastic(CM1),partial

CSB-RP134794Pl
Regular price
$1,151.28 CAD
Sale price
$1,151.28 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Cardiovascular

Uniprot ID: P42738

Gene Names: APX1

Organism: Arabidopsis thaliana (Mouse-ear cress)

AA Sequence: ASLLMRSSCCSSAIGGFFDHRRELSTSTPISTLLPLPSTKSSFSVRCSLPQPSKPRSGTSSVHAVMTLAGSLTGKKRVDESESLTLEGIRNSLIRQEDSIIFGLLERAKYCYNADTYDPTAFDMDGFNGSLVEYMVKGTEKLHAKVGRFKSPDEHPFFPDDLPEPMLPPLQYPKVLHFAADSININKKIWNMYFRDLVPRLVKKGDDGNYGSTAVCDAICLQCLSKRIHYGKFVAEAKFQASPEA

Expression Region: 3-247aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 31.1 kDa

Alternative Name(s): CM-1

Relevance: May play a role in chloroplast biogenesis.Curated

Reference: Identification, characterization and comparative analysis of a novel chorismate mutase gene in Arabidopsis thaliana.Mobley E.M., Kunkel B.N., Keith B.Gene 240:115-123(1999)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share