Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P92918
Gene Names: N/A
Organism: Apium graveolens (Celery)
AA Sequence: MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLGEATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEFVVVPTDGGCIVKNTTIYNTKGDAVLPEDKIKEATEKSALAFKAVEAYLLANLQFLA
Expression Region: 1-159aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 33.1 kDa
Alternative Name(s):
Relevance:
Reference: Characterization of Api g 1.0201, a new member of the Api g 1 family of Celery Allergens.Hoffmann-Sommergruber K., Ferris R., Pec M., Radauer G., O'Riordain G., Camara-Machado O., Scheiner O., Breiteneder H.Int. Arch. Allergy Immunol. 122:115-123(2000)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.