Size:100ug. Other sizes are also available. For further information, please contact us.
Research Areas:Others
Uniprot ID:Q5J8R1
Gene Names:N/A
Organism:Apis mellifera carnica (Carniolan honeybee)
AA Sequence:VTCDLLSFKGQVNDSACAANCLSLGKAGGHCEKGVCICRKTSFKDLWDKRF
Expression Region:44-94aa
Sequence Info:Full Length of Mature Protein
Source:E.coli
Tag Info:N-terminal 6xHis-KSI-tagged
MW:20.9 kDa
Alternative Name(s):Defensin-1
Relevance:Found in royal jelly and in hemolymph, potent antibacterial protein against Gram-positive bacteria at low concentration.
Reference:"Silencing of Apis mellifera dorsal genes reveals their role in expression of the antimicrobial peptide defensin-1." Lourenco A.P., Florecki M.M., Simoes Z.L.P., Evans J.D. Insect Mol Biol 27:577-589(2018)
Purity:Greater than 85% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
Lead Time Guidance:3-7 business days