
Size:100ug. Other sizes are also available. For further information, please contact us.
Research Areas:Others
Uniprot ID:P20540
Gene Names:L1R
Organism:Vaccinia virus (strain Copenhagen) (VACV)
AA Sequence:GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPRQVAGTG
Expression Region:2-183aa
Sequence Info:Partial
Source:Yeast
Tag Info:N-terminal 10xHis-tagged and C-terminal 6xHis-Myc-tagged
MW:25.4 kDa
Alternative Name(s):Protein L1(Virion membrane protein M25)
Relevance:Envelope protein which probably plays a role in virus entry into the host cell. Is probably involved in the virus attachment to the host cell surface and associates with the entry/fusion complex (EFC). Needed for fusion and penetration of the virus core into host cell (By similarity).
Reference:"Identification and analysis of three myristylated vaccinia virus late proteins." Martin K.H., Grosenbach D.W., Franke C.A., Hruby D.E. J. Virol. 71:5218-5226(1997)
Purity:Greater than 90% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
Lead Time Guidance:25-35 business days
You may also like
-
Recombinant Vaccinia virus Protein L1(L1R),partial
- Regular price
- £624.00 GBP
- Sale price
- £624.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Vaccinia virus Protein L1(VACWR088),partial
- Regular price
- £624.00 GBP
- Sale price
- £624.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Vaccinia virus Protein L1 (L1R)
- Regular price
- £952.00 GBP
- Sale price
- £952.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Vaccinia virus 14 kDa fusion protein(A27L)
- Regular price
- £597.00 GBP
- Sale price
- £597.00 GBP
- Regular price
-
- Unit price
- per
Sold out