Recombinant Ustilago maydis P6 virus KP6 killer toxin

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Ustilago maydis P6 virus KP6 killer toxin

CSB-EP325875UBC
Regular price
£665.00 GBP
Sale price
£665.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P16948

Gene Names: N/A

Organism: Ustilago maydis P6 virus (UmV6) (UmV-P6)

AA Sequence: NNAFCAGFGLSCKWECWCTAHGTGNELRYATAAGCGDHLSKSYYDARAGHCLFSDDLRNQFYSHCSSLNNNMSCRSLS

Expression Region: 28-105aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 24.6 kDa

Alternative Name(s):

Relevance: This protein is lethal to sensitive cells of the same or related species. The KP6 alpha subunit is known to recognize some cellular receptors before interaction of the complex with KP6 beta, precipitating cell death.

Reference: Structure of Ustilago maydis killer toxin KP6 alpha-subunit. A multimeric assembly with a central pore.Li N., Erman M., Pangborn W., Duax W.L., Park C.M., Bruenn J., Ghosh D.J. Biol. Chem. 274:20425-20431(1999)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share