Recombinant Triticum aestivum Glutenin, high molecular weight subunit DX5(GLU-1D-1D),partial

Recombinant Triticum aestivum Glutenin, high molecular weight subunit DX5(GLU-1D-1D),partial

CSB-EP319188TQN
Regular price
£644.00 GBP
Sale price
£644.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Others

Uniprot ID:P10388

Gene Names:GLU-1D-1D

Organism:Triticum aestivum(Wheat)

AA Sequence:EGEASEQLQCERELQELQERELKACQQVMDQQLRDISPECHPVVVSPVAGQYEQQIVVPPKGGSFYPGETTPPQQLQQRIFWGIPALLKRYYPSVTCPQQVSYYPGQASPQRPGQGQQPGQGQQGYYPTSPQQPGQWQQPEQGQPRYYPTSPQQSGQLQQPAQGQQPGQGQQG

Expression Region:22-194aa

Sequence Info:partial

Source:E.coli

Tag Info:C-terminal 10xHis-tagged

MW:20.8 kDa

Alternative Name(s):GLU-D1-1B

Relevance:Glutenins are high-molecular weight seed storage proteins of wheat endosperm. Thought to be responsible for the visco-elastic property of wheat dough.

Reference:"Starch characteristics of transgenic wheat (Triticum aestivum L.) overexpressing the Dx5 high molecular weight glutenin subunit are substantially equivalent to those in nonmodified wheat." Beckles D.M., Tananuwong K., Shoemaker C.F. J. Food Sci. 77:C437-42(2012)

Purity:Greater than 90% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Lead Time Guidance:13-23 business days

Your list is ready to share