Recombinant Streptococcus pyogenes serotype M1 Adenine phosphoribosyltransferase(apt)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Streptococcus pyogenes serotype M1 Adenine phosphoribosyltransferase(apt)

CSB-YP001954SMT
Regular price
£712.00 GBP
Sale price
£712.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: others

Target / Protein: apt

Biologically active: Not Tested

Expression system: Yeast

Species of origin: Streptococcus pyogenes serotype M1

Delivery time: 3-7 business days

Uniprot ID: P63546

AA Sequence: MDLTNYIASIKDYPKAGITFRDISPLMADGKAYSYAIREIAQYACDKDIDMVVGPEARGFIIGCPVAVELGIGFAPVRKPGKLPRDVVSADYEKEYGLDTLTMHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLGGIVAGCAFLIELEGLNGRHAIRNYDYKVLMQFPG

Tag info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-172aa

Protein length: Full Length

MW: 22.7 kDa

Alternative Name(s):

Relevance: Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis.

Reference: "Evolutionary origin and emergence of a highly successful clone of serotype M1 group A Streptococcus involved multiple horizontal gene transfer events." Sumby P., Porcella S.F., Madrigal A.G., Barbian K.D., Virtaneva K., Ricklefs S.M., Sturdevant D.E., Graham M.R., Vuopio-Varkila J., Hoe N.P., Musser J.M. J. Infect. Dis. 192:771-782(2005)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share