Recombinant Staphylococcus aureus Toxic shock syndrome toxin-1(tst)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Staphylococcus aureus Toxic shock syndrome toxin-1(tst)

CSB-EP361973FKZ
Regular price
£652.00 GBP
Sale price
£652.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171228

Research areas: Others

Target / Protein: tst

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Staphylococcus aureus

Delivery time: 3-7 business days

Uniprot ID: P06886

AA Sequence: STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYGPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 41-234aa

Protein length: Full Length of Mature Protein

MW: 37.9 kDa

Alternative Name(s): TSST-1

Relevance: Responsible for the symptoms of toxic shock syndrome.

Reference: "The nucleotide and partial amino acid sequence of toxic shock syndrome toxin-1."Blomster-Hautamaa D.A., Kreiswirth B.N., Kornblum J.S., Novick R.P., Schlievert P.M.J. Biol. Chem. 261:15783-15786(1986)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share