Recombinant Saccharomyces cerevisiae Inositol phosphorylceramide synthase catalytic subunit AUR1(AUR1),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Saccharomyces cerevisiae Inositol phosphorylceramide synthase catalytic subunit AUR1(AUR1),partial

CSB-EP334079SVG1
Regular price
£537.00 GBP
Sale price
£537.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P36107

Gene Names: AUR1

Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

AA Sequence: TKYTHLPIVDTSLFCRWSYTSIEKYDISKSDPLAADSNDIESVPLSNLELDFDLNMTDEPSVSPSLFDGSTSVSRSSATSITSLGVKRA

Expression Region: 313-401aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 10xHis-B2M-tagged and C-terminal Myc-tagged

MW: 26.7 kDa

Alternative Name(s): Aureobasidin A resistance protein Phosphatidylinositol:ceramide phosphoinositol transferase

Relevance: Catalytic component of the inositol phosphorylceramide synthase which catalyzes the addition of a phosphorylinositol group onto ceramide to form inositol phosphorylceramide, an essential step in sphingolipid biosynthesis.

Reference: "AUR1, a novel gene conferring aureobasidin resistance on Saccharomyces cerevisiae: a study of defective morphologies in Aur1p-depleted cells." Hashida-Okado T., Ogawa A., Endo M., Yasumoto R., Takesako K., Kato I. Mol. Gen. Genet. 251:236-244(1996)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share