Recombinant Saccharomyces cerevisiae GTP-binding protein YPT1(YPT1)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Saccharomyces cerevisiae GTP-binding protein YPT1(YPT1)

CSB-EP360492SVG
Regular price
£630.00 GBP
Sale price
£630.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P01123

Gene Names: YPT1

Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

AA Sequence: MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNETTQKKEDKGNVNLKGQSLTNTGGGCC

Expression Region: 1-206aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 39.2 kDa

Alternative Name(s): Protein YP2 Rab GTPase YPT1 Transport GTPase YPT1

Relevance: The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. YPT1 regulates the trafficking of secretory vesicles from the endoplasmic reticulum (ER) to the Golgi. Vesicular transport depends on shuttling of YPT1 between membrane and cytosol by GDI1, probably by recycling it to its membrane of origin after a vesicle fusion event. Plays a role in the initial events of the autophagic vacuole development which take place at specialized regions of the endoplasmic reticulum. Also involved in the recycling of membrane proteins.

Reference: "A yeast gene encoding a protein homologous to the human c-has/bas proto-oncogene product."Gallwitz D., Donath C., Sander C.Nature 306:704-707(1983)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Saccharomyces cerevisiae GTP-binding protein YPT1(YPT1)
    Regular price
    £691.00 GBP
    Sale price
    £691.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Ras-related protein Rab-1A(RAB1A)
    Regular price
    £419.00 GBP
    Sale price
    £419.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Ras-related protein Rab-1A(RAB1A)
    Regular price
    £419.00 GBP
    Sale price
    £419.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Ras-related protein Rab-11A(RAB11A)
    Regular price
    £419.00 GBP
    Sale price
    £419.00 GBP
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share