Recombinant Rat Peripheral myelin protein 22(Pmp22)

Recombinant Rat Peripheral myelin protein 22(Pmp22)

CSB-CF018241RA
Regular price
£1,538.00 GBP
Sale price
£1,538.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:20ug. Other sizes are also available. For further information, please contact us.

Research Areas:Neuroscience

Uniprot ID:P25094

Gene Names:Pmp22

Organism:Rattus norvegicus (Rat)

AA Sequence:MLLLLLGILFLHIAVLVLLFVSTIVSQWLVGNGHRTDLWQNCTTSALGAVQHCYSSSVSEWLQSVQATMILSVIFSVLSLFLFFCQLFTLTKGGRFYITGVFQILAGLCVMSAAAIYTVRHSEWHVNNDYSYGFAYILAWVAFPLALLSGIIYVILRKRE

Expression Region:1-160aa

Sequence Info:Full Length

Source:in vitro E.coli expression system

Tag Info:N-terminal 10xHis-tagged

MW:23.4 kDa

Alternative Name(s):Protein CD25 (SR13 myelin protein) (Schwann cell membrane glycoprotein) (SAG) (Cd25) (Pmp-22)

Relevance:Might be involved in growth regulation, and in myelinization in the peripheral nervous system.

Reference:"Axon-regulated expression of a Schwann cell transcript that is homologous to a 'growth arrest-specific' gene." Spreyer P., Kuhn G., Hanemann C.O., Gillen C., Schaal H., Kuhn R., Lemke G., Mueller H.W. EMBO J. 10:3661-3668(1991)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:Might be involved in growth regulation, and in myelinization in the peripheral nervous system.

Involvement in disease:

Subcellular Location:Cell membrane, Multi-pass membrane protein

Protein Families:PMP-22/EMP/MP20 family

Tissue Specificity:Found exclusively in the peripheral nervous system. Present in both myelinating and nonmyelinating Schwann cells. Found in the tumors of Schwann cell lineage where axons are present (neurofibromas) but not where axons are absent (schwannomas).

Paythway:

HGNC Database Link:

UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Rn&CID=1476

KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?rno:24660

STRING Database Link:https://string-db.org/network/10116.ENSRNOP00000051201

OMIM Database Link:

Lead Time Guidance:3-7 business days

Your list is ready to share