
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Others
Uniprot ID: P50280
Gene Names: Mmp7
Organism: Rattus norvegicus (Rat)
AA Sequence: FSLMPNSPKWHSRTVTYRIVSYTTDLPRFLVDQIVKRALRMWSMQIPLNFKRVSWGTADIIIGFARGDHGDNFPFDGPGNTLGHAFAPGPGLGGDAHFDKDEYWTDGEDSGVNFLFVATHELGHSLGLGHSSVPSSVMYPTYQGDHSEDFSLTKDDIAGIQKLYGKRNKL
Expression Region: 98-267aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 20.9 kDa
Alternative Name(s): Matrin;Matrix metalloproteinase-7 ;MMP-7Pump-1 proteaseUterine metalloproteinase
Relevance: Degrades casein, gelatins of types I, III, IV, and V, and fibronectin. Activates procollagenase .
Reference: Characterization of rat uterine matrilysin and its cDNA. Relationship to human pump-1 and activation of procollagenases.Abramson S.R., Conner G.E., Nagase H., Neuhaus I., Woessner J.F.J. Biol. Chem. 270:16016-16022(1995)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Rat Matrilysin(Mmp7)
- Regular price
- £535.00 GBP
- Sale price
- £535.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Matrilysin(MMP7)
- Regular price
- £419.00 GBP
- Sale price
- £419.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
MMP7 Antibody, Biotin conjugated - Cat. #: CSB-PA07455D0Rb
- Regular price
- £255.00 GBP
- Sale price
- £255.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
MMP7 Antibody, HRP conjugated - Cat. #: CSB-PA07455B0Rb
- Regular price
- £255.00 GBP
- Sale price
- £255.00 GBP
- Regular price
-
- Unit price
- per
Sold out