Recombinant Rat Artemin(Artn)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Rat Artemin(Artn)

CSB-EP002160RA
Regular price
£631.00 GBP
Sale price
£631.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Neuroscience

Uniprot ID: Q6AYE8

Gene Names: Artn

Organism: Rattus norvegicus (Rat)

AA Sequence: AGTRSSRARATDARGCRLRSQLVPVSALGLGHSSDELIRFRFCSGSCRRARSPHDLSLASLLDAGALRSPPGSRPISQPCCRPTRYEAVSFMDVNSTWRTVDHLSATACGCLG

Expression Region: 112-224aa

Sequence Info: Full Length of Mature Protein

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW: 19.1 kDa

Alternative Name(s):

Relevance: Ligand for the GFR-alpha-3-RET receptor complex but can also activate the GFR-alpha-1-RET receptor complex. Supports the survival of sensory and sympathetic peripheral neurons in culture and also supports the survival of dopaminergic neurons of the ventral mid-brain. Strong attractant of gut hematopoietic cells thus promoting the formation Peyer's patch-like structures, a major component of the gut-associated lymphoid tissue

Reference: "Artemin, a novel member of the GDNF ligand family, supports peripheral and central neurons and signals through the GFRalpha3-RET receptor complex." Baloh R.H., Tansey M.G., Lampe P.A., Fahrner T.J., Enomoto H., Simburger K.S., Leitner M.L., Araki T., Johnson E.M. Jr., Milbrandt J. Neuron 21:1291-1302(1998)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Rat Beta-nerve growth factor(Ngf),Partial
    Regular price
    £537.00 GBP
    Sale price
    £537.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Rat Beta-nerve growth factor(Ngf)
    Regular price
    £535.00 GBP
    Sale price
    £535.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Rat Hepatocyte growth factor(Hgf),partial
    Regular price
    £537.00 GBP
    Sale price
    £537.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Rat Brain-derived neurotrophic factor(Bdnf),partial
    Regular price
    £537.00 GBP
    Sale price
    £537.00 GBP
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share