
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Cardiovascular
Target / Protein: APOE
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Oryctolagus cuniculus (Rabbit)
Delivery time: 3-7 business days
Uniprot ID: P18287
AA Sequence: TEQEVEVPEQARWKAGQPWELALGRFWDYLRWVQSLSDQVQEELLSSQVTQELTMLMEETMKEVKAYKSELEEQLSPMAQEHRARLSKELQVAGALEADMEDVCNRLAQYRGEAQAMLGQSTEELARAFSSHLRKLRKRLLRDAEDLQKRMAVYGAGAREGAERGVSAVRERLGSRLERGRLRVATVGTLAGRPLRERAQAWGERLRGHLEEVGSRARDRLNEVREQVEEVRVKVEEQAPQMRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKLQAAMPSKAPAAAPIENQ
Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Expression Region: 20-311aa
Protein length: Partial
MW: 53.6 kDa
Alternative Name(s):
Relevance: Mediates the binding, internalization, and catabolism of lipoprotein particles. It can serve as a ligand for the LDL (apo B/E) receptor and for the specific apo-E receptor (chylomicron remnant) of hepatic tissues.
Reference: "Isolation and characterization of a full-length rabbit apolipoprotein E cDNA." Hao Q.L., Yamin T.T., Pan T.C., Chen S.L., Chen B.S., Kroon P.A., Chao Y.S. Atherosclerosis 66:125-130(1987)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Rabbit Apolipoprotein E(APOE),partial
- Regular price
- £645.00 GBP
- Sale price
- £645.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Rabbit Apolipoprotein E(APOE),partial
- Regular price
- £645.00 GBP
- Sale price
- £645.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Rabbit Apolipoprotein E(APOE),partial
- Regular price
- £645.00 GBP
- Sale price
- £645.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Rabbit Apolipoprotein E(APOE),partial
- Regular price
- £645.00 GBP
- Sale price
- £645.00 GBP
- Regular price
-
- Unit price
- per
Sold out